Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADRB3 Peptide - middle region

ADRB3 Peptide - middle region

Product Specifications

Product Name Alternative

BETA3AR

UniProt

P13945

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_000016.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LCVTASIETLCALAVDRYLAVTNPLRYGALVTKRCARTAVVLVWVVSAAV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Calcium D-gluconate monohydrate
TRC-C145103-100MG 100 mg

Calcium D-gluconate monohydrate

Sign In for Pricing
View Details
CD31 / PECAM-1 (Endothelial Cell Marker) (PECAM1/3526), CF647 conjugate, 0.1mg/mL
BNC473526-100 1x 100 µL

CD31 / PECAM-1 (Endothelial Cell Marker) (PECAM1/3526), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
1,5,6-Trichloroacenaphthene
TRC-T773890-10MG 10 mg

1,5,6-Trichloroacenaphthene

Sign In for Pricing
View Details
SKIP (INPP5K) (NM_016532) Human Over-expression Lysate
LC402561 20 µg

SKIP (INPP5K) (NM_016532) Human Over-expression Lysate

Sign In for Pricing
View Details
HIC5 (TGFB1I1) (NM_001164719) Human Over-expression Lysate
LY431927 100 µg

HIC5 (TGFB1I1) (NM_001164719) Human Over-expression Lysate

Sign In for Pricing
View Details
FAM86B2 (NM_001137610) Human Over-expression Lysate
LC427947 20 µg

FAM86B2 (NM_001137610) Human Over-expression Lysate

Sign In for Pricing
View Details