Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADRB3 Peptide - middle region

ADRB3 Peptide - middle region

Product Specifications

Product Name Alternative

BETA3AR

UniProt

P13945

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_000016.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LCVTASIETLCALAVDRYLAVTNPLRYGALVTKRCARTAVVLVWVVSAAV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C1QA / Complement C1q A-Chain (C1QA/2952), CF647 conjugate, 0.1mg/mL
BNC472952-500 1x 500 µL

C1QA / Complement C1q A-Chain (C1QA/2952), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HCFC1 Human Gene Knockout Kit (CRISPR)
KN415341 1 Kit

HCFC1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
DPEP3 (NM_001129758) Human Over-expression Lysate
LC427042 20 µg

DPEP3 (NM_001129758) Human Over-expression Lysate

Sign In for Pricing
View Details
4-Acetamidophenyl beta-D-Glucuronide-d3 Sodium Salt
TRC-A158502-25MG 25 mg

4-Acetamidophenyl beta-D-Glucuronide-d3 Sodium Salt

Sign In for Pricing
View Details
ZFAND1 (NM_001170797) Human Over-expression Lysate
LC432719 20 µg

ZFAND1 (NM_001170797) Human Over-expression Lysate

Sign In for Pricing
View Details
BCL-2 (Ab-69) Antibody
8B0774-AAT 50 µg

BCL-2 (Ab-69) Antibody

Sign In for Pricing
View Details