Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC16A7 Peptide - middle region

SLC16A7 Peptide - middle region

Product Specifications

Product Name Alternative

MCT2

UniProt

O60669

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001257551.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LQPALTIIGKYFYRKRPMANGLAMAGSPVFLSSLAPFNQYLFNTFGWKGS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRF2 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated
bs-22935R-BF750 100 µL

TRF2 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
Recombinant Human B-cell Maturation Protein/BCMA/TNFRSF17 (C-Fc)
CS79-10ug 10 µg

Recombinant Human B-cell Maturation Protein/BCMA/TNFRSF17 (C-Fc)

Sign In for Pricing
View Details
FST siRNA (Rat)
orb1833802-01 15 nmol

FST siRNA (Rat)

Sign In for Pricing
View Details
FST siRNA (Rat)
orb1833802-02 30 nmol

FST siRNA (Rat)

Sign In for Pricing
View Details
THRA Polyclonal Antibody, Biotin Conjugated
A50531-100 100 µL

THRA Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
Human PARP15 (NM_001113523) AAV Particle
RC226085A1V 250 µL

Human PARP15 (NM_001113523) AAV Particle

Sign In for Pricing
View Details