Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC16A7 Peptide - middle region

SLC16A7 Peptide - middle region

Product Specifications

Product Name Alternative

MCT2

UniProt

O60669

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001257551.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LQPALTIIGKYFYRKRPMANGLAMAGSPVFLSSLAPFNQYLFNTFGWKGS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CKMT2 siRNA (Human)
CRH0832-01 15 nmol

CKMT2 siRNA (Human)

Sign In for Pricing
View Details
CKMT2 siRNA (Human)
CRH0832-02 30 nmol

CKMT2 siRNA (Human)

Sign In for Pricing
View Details
RCE1 CytoSection
TS410814P5 25 Slides

RCE1 CytoSection

Sign In for Pricing
View Details
BNC1 (NM_001717) Human Tagged ORF Clone
RC219726 10 µg

BNC1 (NM_001717) Human Tagged ORF Clone

Sign In for Pricing
View Details
TRIM30B CRISPR Activation Plasmid (m)
sc-434046-ACT 20 µg

TRIM30B CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
HER-2 / CD340 (ERB2/776), 1mg/mL
BNUM0776-50 1x 50 µL

HER-2 / CD340 (ERB2/776), 1mg/mL

Sign In for Pricing
View Details