HBB Peptide - N-terminal region
HBB Peptide - N-terminal region
Product Specifications
Product Name Alternative
CD113t-C, beta-globin
UniProt
P68871
Field of Research
Cancer Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_000509.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: VHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLST
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
bs-7230R-RBITC 100 µL
ZNF336/GZF1 Polyclonal Antibody, RBITC Conjugated
Sign In for Pricing
View Details 
orb2930016-01 20 µg
Recombinant Oryza sativa subsp. japonica Copper transporter 6 (COPT6)
Sign In for Pricing
View Details orb2930016-02 100 µg
Recombinant Oryza sativa subsp. japonica Copper transporter 6 (COPT6)
Sign In for Pricing
View Details HY-W011537-01 5 g
(S) -2- ((tert-Butoxycarbonyl) amino) -3- (4-fluorophenyl) propanoic acid
Sign In for Pricing
View Details HY-W011537-02 10 g
(S) -2- ((tert-Butoxycarbonyl) amino) -3- (4-fluorophenyl) propanoic acid
Sign In for Pricing
View Details