Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSEN1 Peptide - N-terminal region

PSEN1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

AD3, FAD, PS1, PS-1, S182

UniProt

P49768

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_000012.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GNSRQVVEQDEEEDEELTLKYGAKHVIMLFVPVTLCMVVVVATIKSVSFY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD35 / CR1 (E11), CF640R conjugate, 0.1mg/mL
BNC400040-500 1x 500 µL

CD35 / CR1 (E11), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF405S conjugate, 0.1mg/mL
BNC040525-500 1x 500 µL

CD63 (MX-49.129.5), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP27 (G3.1), CF640R conjugate, 0.1mg/mL
BNC400861-100 1x 100 µL

HSP27 (G3.1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-X (Apoptosis Marker) (BCL2L1/2406), CF640R conjugate, 0.1mg/mL
BNC402406-100 1x 100 µL

Bcl-X (Apoptosis Marker) (BCL2L1/2406), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (A103), CF640R conjugate, 0.1mg/mL
BNC400668-100 1x 100 µL

MART-1 / Melan-A (A103), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (UCHL-1), CF568 conjugate, 0.1mg/mL
BNC680003-100 1x 100 µL

CD45RO (UCHL-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details