Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NR1H3 Peptide - middle region

NR1H3 Peptide - middle region

Product Specifications

Product Name Alternative

LXRA, LXR-a, RLD-1

UniProt

Q13133

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001123573.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LEAAEPTALLTRAEPPSEPTEIRPQKRKKGPAPKMLGNELCSVCGDKASG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CF®680 Goat Anti-Mouse IgM (Mu Chain), 2mg/mL
#20384-50uL 1x 50 µL

CF®680 Goat Anti-Mouse IgM (Mu Chain), 2mg/mL

Sign In for Pricing
View Details
OKCD01857-96W - Cacna1f ELISA Kit (Mouse)
OKCD01857-96W 96 Well

OKCD01857-96W - Cacna1f ELISA Kit (Mouse)

Sign In for Pricing
View Details
GLTP (m) -PR
sc-145440-PR 10 µM - 20 µL

GLTP (m) -PR

Sign In for Pricing
View Details
ZNF663 Antibody (C-term)
E45R31791G-4 50 µL

ZNF663 Antibody (C-term)

Sign In for Pricing
View Details
PRCP Antibody
MBS8527233-01 0.1 mg

PRCP Antibody

Sign In for Pricing
View Details
PRCP Antibody
MBS8527233-02 0.1 mL (AF405L)

PRCP Antibody

Sign In for Pricing
View Details