Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NR1H3 Peptide - middle region

NR1H3 Peptide - middle region

Product Specifications

Product Name Alternative

LXRA, LXR-a, RLD-1

UniProt

Q13133

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001123573.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LEAAEPTALLTRAEPPSEPTEIRPQKRKKGPAPKMLGNELCSVCGDKASG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-PPAR gamma/PPARG Antibody Picoband® Fluoro550 Conjugated
A00449-3-Fluoro550 100 µg/Vial

Anti-PPAR gamma/PPARG Antibody Picoband® Fluoro550 Conjugated

Sign In for Pricing
View Details
ALKBH7 CRISPR Activation Plasmid (m)
sc-425997-ACT 20 µg

ALKBH7 CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
NeuroD2 Recombinant Protein (Mouse)
RP153770 100 µg

NeuroD2 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
C15orf24 AAV siRNA Pooled Vector
13876161 1.0 µg

C15orf24 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
VAC14 rabbit pAb
E28PN5198 100 µL

VAC14 rabbit pAb

Sign In for Pricing
View Details
Recombinant Acinetobacter sp. DNA polymerase IV (dinB)
MBS1448431-01 0.02 mg (E-Coli)

Recombinant Acinetobacter sp. DNA polymerase IV (dinB)

Sign In for Pricing
View Details