FEN1 Peptide - C-terminal region
FEN1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
MF1, RAD2, FEN-1
UniProt
P39748
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_004102.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SRQGSTQGRLDDFFKVTGSLSSAKRKEPEPKGSTKKKAKTGAAGKFKRGK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
27825121 3x 1.0µg DNA
LY75-CD302 CRISPRa sgRNA lentivector (set of three targets)(Human)
Sign In for Pricing
View Details 
QY-E110021 96 Tests
Simian Stress Induced Phosphoprotein 1 (STIP1) ELISA Kit
Sign In for Pricing
View Details K3687805 3x 1.0 µg
4632428N05Rik sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
Sign In for Pricing
View Details MBS2168111-01 0.1 mL
HRP-Linked Monoclonal Antibody to Glutathione S Transferase Alpha 1 (GSTa1)
Sign In for Pricing
View Details MBS2168111-02 0.2 mL
HRP-Linked Monoclonal Antibody to Glutathione S Transferase Alpha 1 (GSTa1)
Sign In for Pricing
View Details