FEN1 Peptide - C-terminal region
FEN1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
MF1, RAD2, FEN-1
UniProt
P39748
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_004102.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SRQGSTQGRLDDFFKVTGSLSSAKRKEPEPKGSTKKKAKTGAAGKFKRGK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS9360617-01 48 Well
Monkey BCL2/Adenovirus E1B 19kDa Protein-Interacting Protein 3 (BNIP3) ELISA Kit
Sign In for Pricing
View Details MBS9360617-02 96 Well
Monkey BCL2/Adenovirus E1B 19kDa Protein-Interacting Protein 3 (BNIP3) ELISA Kit
Sign In for Pricing
View Details