Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FANCC Peptide - C-terminal region

FANCC Peptide - C-terminal region

Product Specifications

Product Name Alternative

FA3, FAC, FACC

UniProt

Q00597

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_000127.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LLWAPGGHTIAWDVITLMAHTAEITHEIIGFLDQTLYRWNRLGIESPRSE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant PDGFB Antibody
RC-5199-01 50 μL

Recombinant PDGFB Antibody

Sign In for Pricing
View Details
Recombinant PDGFB Antibody
RC-5199-02 100 µL

Recombinant PDGFB Antibody

Sign In for Pricing
View Details
Recombinant PDGFB Antibody
RC-5199-03 1 mL

Recombinant PDGFB Antibody

Sign In for Pricing
View Details
MEKK2 (MAP3K2) Human Knockdown Lysate
LY300503 100 µg

MEKK2 (MAP3K2) Human Knockdown Lysate

Sign In for Pricing
View Details
BZW2 (NM_001159767) Human Over-expression Lysate
LC431914 20 µg

BZW2 (NM_001159767) Human Over-expression Lysate

Sign In for Pricing
View Details
HIVEP2 Antibody
OC-2255-01 50 μL

HIVEP2 Antibody

Sign In for Pricing
View Details