Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FANCC Peptide - C-terminal region

FANCC Peptide - C-terminal region

Product Specifications

Product Name Alternative

FA3, FAC, FACC

UniProt

Q00597

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_000127.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LLWAPGGHTIAWDVITLMAHTAEITHEIIGFLDQTLYRWNRLGIESPRSE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human OBFC1/STN1 Protein (His Tag)
PKSH032832-01 10 µg

Recombinant Human OBFC1/STN1 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human OBFC1/STN1 Protein (His Tag)
PKSH032832-02 50 µg

Recombinant Human OBFC1/STN1 Protein (His Tag)

Sign In for Pricing
View Details
Activin Receptor Type IA (ACVR1) (N-term) Rabbit Polyclonal Antibody
AP13707PU-N 400 µL

Activin Receptor Type IA (ACVR1) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS707525 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Polystyrene M RAM
HAM2023.1G 1 g

Polystyrene M RAM

Sign In for Pricing
View Details
Mouse SLC (Secondary Lymphoid Tissue Chemokine) ELISA Kit
E-EL-M0145-01 24 Tests

Mouse SLC (Secondary Lymphoid Tissue Chemokine) ELISA Kit

Sign In for Pricing
View Details