Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HDGF Peptide - middle region

HDGF Peptide - middle region

Product Specifications

Product Name Alternative

HMG1L2

UniProt

P51858

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001119522.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: THETAFLGPKDLFPYEESKEKFGKPNKRKGFSEGLWEIENNPTVKASGYQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Csul Antibody
orb804075 2 mg

Csul Antibody

Sign In for Pricing
View Details
Anti-c-Kit Antibody (FITC), Mouse Monoclonal
MBS8106086-01 25 Tests

Anti-c-Kit Antibody (FITC), Mouse Monoclonal

Sign In for Pricing
View Details
Anti-c-Kit Antibody (FITC), Mouse Monoclonal
MBS8106086-02 100 Tests

Anti-c-Kit Antibody (FITC), Mouse Monoclonal

Sign In for Pricing
View Details
Anti-c-Kit Antibody (FITC), Mouse Monoclonal
MBS8106086-03 5x 100 Tests

Anti-c-Kit Antibody (FITC), Mouse Monoclonal

Sign In for Pricing
View Details
Mouse Monoclonal Cav1.4 Antibody (1H6)
H00000778-M05 0.1 mg

Mouse Monoclonal Cav1.4 Antibody (1H6)

Sign In for Pricing
View Details
H mgA1 (13B3) Rabbit Monoclonal Antibody
E28M5637 100 µL

H mgA1 (13B3) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details