HDGF Peptide - middle region
HDGF Peptide - middle region
Product Specifications
Product Name Alternative
HMG1L2
UniProt
P51858
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001119522.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: THETAFLGPKDLFPYEESKEKFGKPNKRKGFSEGLWEIENNPTVKASGYQ
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS7203109-01 48 Well
Mouse Olfactory receptor 13G1 (OR13G1) ELISA Kit
Sign In for Pricing
View Details MBS7203109-02 96 Well
Mouse Olfactory receptor 13G1 (OR13G1) ELISA Kit
Sign In for Pricing
View Details MBS7203109-03 5x 96 Well
Mouse Olfactory receptor 13G1 (OR13G1) ELISA Kit
Sign In for Pricing
View Details MBS7203109-04 10x 96 Well
Mouse Olfactory receptor 13G1 (OR13G1) ELISA Kit
Sign In for Pricing
View Details V9569SAF-100UG 100 µg
RPA32 Antibody / RPA2 / Replication Protein A2
Sign In for Pricing
View Details