Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NISCH Peptide - C-terminal region

NISCH Peptide - C-terminal region

Product Specifications

Product Name Alternative

I-1, IR1, IRAS, hIRAS

UniProt

Q9Y2I1

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001263222.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LLDEDCVHYPLPEFAKEPPQRDRYRLDDGRRVRDLDRVLMGYQTYPQALT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dystrophin (DMD) (Marker of Duchenne and Becker Muscular Dystrophy) (DMD/3245), CF640R conjugate, 0.1mg/mL
BNC403245-500 1x 500 µL

Dystrophin (DMD) (Marker of Duchenne and Becker Muscular Dystrophy) (DMD/3245), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
prothymosin, alpha (PTMA) Rabbit Polyclonal Antibody
AP02227SU-N 100 µL

prothymosin, alpha (PTMA) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Runx2 activation kit by CRISPRa
GA200553 1 Kit

Mouse Runx2 activation kit by CRISPRa

Sign In for Pricing
View Details
RPS14 Rabbit Polyclonal Antibody
TA366373 100 µL

RPS14 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FXYD7 (NM_022006) Human Recombinant Protein
TP305819 20 µg

FXYD7 (NM_022006) Human Recombinant Protein

Sign In for Pricing
View Details
CD11b / MAC-1 (Microglial Marker) (ITGAM/3339), CF568 conjugate, 0.1mg/mL
BNC683339-500 1x 500 µL

CD11b / MAC-1 (Microglial Marker) (ITGAM/3339), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details