Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NISCH Peptide - C-terminal region

NISCH Peptide - C-terminal region

Product Specifications

Product Name Alternative

I-1, IR1, IRAS, hIRAS

UniProt

Q9Y2I1

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001263222.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LLDEDCVHYPLPEFAKEPPQRDRYRLDDGRRVRDLDRVLMGYQTYPQALT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse MAPτ (Microtubule Associated Protein Tau/Tau Protein) CLIA Kit
E-CL-M0632-01 24 Tests

Mouse MAPτ (Microtubule Associated Protein Tau/Tau Protein) CLIA Kit

Sign In for Pricing
View Details
Mouse MAPτ (Microtubule Associated Protein Tau/Tau Protein) CLIA Kit
E-CL-M0632-02 48 Tests

Mouse MAPτ (Microtubule Associated Protein Tau/Tau Protein) CLIA Kit

Sign In for Pricing
View Details
Mouse MAPτ (Microtubule Associated Protein Tau/Tau Protein) CLIA Kit
E-CL-M0632-03 96 Tests

Mouse MAPτ (Microtubule Associated Protein Tau/Tau Protein) CLIA Kit

Sign In for Pricing
View Details
Human C2ORF47 (MAIP1) activation kit by CRISPRa
GA112459 1 Kit

Human C2ORF47 (MAIP1) activation kit by CRISPRa

Sign In for Pricing
View Details
Piperonyl Butoxide-d9
TRC-P490202-25MG 25 mg

Piperonyl Butoxide-d9

Sign In for Pricing
View Details
MMP-8 Recombinant Rabbit Monoclonal Antibody [JE59-38]
HA721686 100 µL

MMP-8 Recombinant Rabbit Monoclonal Antibody [JE59-38]

Sign In for Pricing
View Details