Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KDM4A Peptide - C-terminal region

KDM4A Peptide - C-terminal region

Product Specifications

Product Name Alternative

JMJD2, JHDM3A, JMJD2A, TDRD14A

UniProt

O75164

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_055478.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ISKHKNGRFYQCEVVRLTTETFYEVNFDDGSFSDNLYPEDIVSQDCLQFG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Semenogelin II (SEMG2) (NM_003008) Human Over-expression Lysate
LY418963 100 µg

Semenogelin II (SEMG2) (NM_003008) Human Over-expression Lysate

Sign In for Pricing
View Details
BPY2 Rabbit Polyclonal Antibody
TA358779 100 µL

BPY2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Stat1 Mouse Gene Knockout Kit (CRISPR)
KN516843 1 Kit

Stat1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant METTL15P1 Antibody
RN-095-01 50 μL

Recombinant METTL15P1 Antibody

Sign In for Pricing
View Details
Recombinant METTL15P1 Antibody
RN-095-02 100 µL

Recombinant METTL15P1 Antibody

Sign In for Pricing
View Details
Recombinant METTL15P1 Antibody
RN-095-03 1 mL

Recombinant METTL15P1 Antibody

Sign In for Pricing
View Details