Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LSM4 Peptide - C-terminal region

LSM4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

GRP, YER112W

UniProt

Q9Y4Z0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_036453.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RGGLQQQKQQKGRGMGGAGRGVFGGRGRGGIPGTGRGQPEKKPGRQAGKQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Caenorhabditis elegans unc-36 Polyclonal Antibody
MBS7156377 Inquire

Rabbit anti-Caenorhabditis elegans unc-36 Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Bovine P53/TP53 protein (His tag)
MBS2580158-01 0.02 mg

Recombinant Bovine P53/TP53 protein (His tag)

Sign In for Pricing
View Details
Recombinant Bovine P53/TP53 protein (His tag)
MBS2580158-02 0.1 mg

Recombinant Bovine P53/TP53 protein (His tag)

Sign In for Pricing
View Details
Recombinant Bovine P53/TP53 protein (His tag)
MBS2580158-03 5x 0.1 mg

Recombinant Bovine P53/TP53 protein (His tag)

Sign In for Pricing
View Details
Porcine Prostaglandin Endoperoxide Synthase 1 ELISA Kit
MBS016071-01 48 Well

Porcine Prostaglandin Endoperoxide Synthase 1 ELISA Kit

Sign In for Pricing
View Details
Porcine Prostaglandin Endoperoxide Synthase 1 ELISA Kit
MBS016071-02 96 Well

Porcine Prostaglandin Endoperoxide Synthase 1 ELISA Kit

Sign In for Pricing
View Details