LSM4 Peptide - C-terminal region
LSM4 Peptide - C-terminal region
Product Specifications
Product Name Alternative
GRP, YER112W
UniProt
Q9Y4Z0
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_036453.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: RGGLQQQKQQKGRGMGGAGRGVFGGRGRGGIPGTGRGQPEKKPGRQAGKQ
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
K0161304 1.0 µg DNA
AXIN2 sgRNA CRISPR Lentivector (Human) (Target 3)
Sign In for Pricing
View Details 
GTR10339656 96 Well
Chicken Calcineurin subunit B type 1 (PPP3R1) ELISA Kit
Sign In for Pricing
View Details 
F0019-76P3 50 µg
Fatty Acid Binding Protein, Liver (FABP) (Biotin) discontinued. See F0019-76V1
Sign In for Pricing
View Details orb3118537 100 µg
DR5/TNFRSF10B Rabbit Polyclonal Antibody (Fluoro647)
Sign In for Pricing
View Details 
MBS1132705-01 0.02 mg (E-Coli)
Recombinant Neisseria meningitidis serogroup A / serotype 4A Major ferric iron-binding protein (fbpA)
Sign In for Pricing
View Details