Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DDX20 Peptide - middle region

DDX20 Peptide - middle region

Product Specifications

Product Name Alternative

DP103, GEMIN3

UniProt

Q9UHI6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_009135.4

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QSGDSESDSDSYSSRTSSQSKGNKSYLEGSSDNQLKDSESTPVDDRISLE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR10G7 (NM_001004463) Human Tagged Lenti ORF Clone
RC213235L4 10 µg

OR10G7 (NM_001004463) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Goat Anti-Human IgM mu chain - Alexa Fluor 405
DL87146A-01 100 µL

Goat Anti-Human IgM mu chain - Alexa Fluor 405

Sign In for Pricing
View Details
Goat Anti-Human IgM mu chain - Alexa Fluor 405
DL87146A-02 500 µL

Goat Anti-Human IgM mu chain - Alexa Fluor 405

Sign In for Pricing
View Details
Goat Anti-Human IgM mu chain - Alexa Fluor 405
DL87146A-03 1 mL

Goat Anti-Human IgM mu chain - Alexa Fluor 405

Sign In for Pricing
View Details
Bak, BH3 Domain (Bcl-2 Homologous Antagonist/Killer, Apoptosis Regulator BAK, Bcl-2-like Protein 7, Bcl2-L-7, BAK1, BCL2L7, CDN1) (PE) discontinued
B0055-10D-PE 200 µL

Bak, BH3 Domain (Bcl-2 Homologous Antagonist/Killer, Apoptosis Regulator BAK, Bcl-2-like Protein 7, Bcl2-L-7, BAK1, BCL2L7, CDN1) (PE) discontinued

Sign In for Pricing
View Details
SNRPE Antibody, Biotin conjugated
MBS7109031-01 0.05 mg

SNRPE Antibody, Biotin conjugated

Sign In for Pricing
View Details