Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DDX20 Peptide - middle region

DDX20 Peptide - middle region

Product Specifications

Product Name Alternative

DP103, GEMIN3

UniProt

Q9UHI6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_009135.4

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QSGDSESDSDSYSSRTSSQSKGNKSYLEGSSDNQLKDSESTPVDDRISLE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine Ephrin B2 HEK293 Overexpression Lysate
MBS8117261-01 0.3 mg

Canine Ephrin B2 HEK293 Overexpression Lysate

Sign In for Pricing
View Details
Canine Ephrin B2 HEK293 Overexpression Lysate
MBS8117261-02 5x 0.3 mg

Canine Ephrin B2 HEK293 Overexpression Lysate

Sign In for Pricing
View Details
KCC2 Rabbit Polyclonal Antibody (Biotin)
orb459885 100 µL

KCC2 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Lentiviral human LCE1F shRNA (UAS) - Lentiviral human LCE1F shRNA (UAS) (100)
GTR15102618 1 Vial

Lentiviral human LCE1F shRNA (UAS) - Lentiviral human LCE1F shRNA (UAS) (100)

Sign In for Pricing
View Details
IDE Peptide - N-terminal region
MBS3225094-01 0.1 mg

IDE Peptide - N-terminal region

Sign In for Pricing
View Details
IDE Peptide - N-terminal region
MBS3225094-02 5x 0.1 mg

IDE Peptide - N-terminal region

Sign In for Pricing
View Details