Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ORC5 Peptide - middle region

ORC5 Peptide - middle region

Product Specifications

Product Name Alternative

ORC5L, ORC5P, ORC5T, PPP1R117

UniProt

O43913

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_002544.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LKHHGKIKKTNFLKKHEKTSNHLLGPKPFPLDRLLAILYSIVDSRVAPTA

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Vibrio parahaemolyticus Phosphate import ATP-binding protein PstB 1 (pstB1)
MBS1293135-01 0.02 mg (E-Coli)

Recombinant Vibrio parahaemolyticus Phosphate import ATP-binding protein PstB 1 (pstB1)

Sign In for Pricing
View Details
Recombinant Vibrio parahaemolyticus Phosphate import ATP-binding protein PstB 1 (pstB1)
MBS1293135-02 0.02 mg (Yeast)

Recombinant Vibrio parahaemolyticus Phosphate import ATP-binding protein PstB 1 (pstB1)

Sign In for Pricing
View Details
Recombinant Vibrio parahaemolyticus Phosphate import ATP-binding protein PstB 1 (pstB1)
MBS1293135-03 0.1 mg (E-Coli)

Recombinant Vibrio parahaemolyticus Phosphate import ATP-binding protein PstB 1 (pstB1)

Sign In for Pricing
View Details
Recombinant Vibrio parahaemolyticus Phosphate import ATP-binding protein PstB 1 (pstB1)
MBS1293135-04 0.1 mg (Yeast)

Recombinant Vibrio parahaemolyticus Phosphate import ATP-binding protein PstB 1 (pstB1)

Sign In for Pricing
View Details
Recombinant Vibrio parahaemolyticus Phosphate import ATP-binding protein PstB 1 (pstB1)
MBS1293135-05 0.02 mg (Baculovirus)

Recombinant Vibrio parahaemolyticus Phosphate import ATP-binding protein PstB 1 (pstB1)

Sign In for Pricing
View Details
Recombinant Vibrio parahaemolyticus Phosphate import ATP-binding protein PstB 1 (pstB1)
MBS1293135-06 0.02 mg (Mammalian-Cell)

Recombinant Vibrio parahaemolyticus Phosphate import ATP-binding protein PstB 1 (pstB1)

Sign In for Pricing
View Details