Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TXK Peptide - middle region

TXK Peptide - middle region

Product Specifications

Product Name Alternative

RLK, TKL, BTKL, PTK4, PSCTK5

UniProt

P42681

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_003319.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VFMGARRSTEAAIKHYQIKKNDSGQWYVAERHAFQSIPELIWYHQHNAAG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ksp-Cadherin / CDH16 (Renal Cell Marker) (CDH16/2125), CF740 conjugate, 0.1mg/mL
BNC742125-100 1x 100 µL

Ksp-Cadherin / CDH16 (Renal Cell Marker) (CDH16/2125), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Neutrophil Elastase (NE) Activity Colorimetric Assay Kit
E-BC-K899-M-01 48 T (32 samples)

Neutrophil Elastase (NE) Activity Colorimetric Assay Kit

Sign In for Pricing
View Details
Neutrophil Elastase (NE) Activity Colorimetric Assay Kit
E-BC-K899-M-02 96 T (80 samples)

Neutrophil Elastase (NE) Activity Colorimetric Assay Kit

Sign In for Pricing
View Details
FMOC-Lys (QSY-7) -OH
5261-AAT 50 mg

FMOC-Lys (QSY-7) -OH

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Mouse Ly6C Antibody[Monts 1]
E-AB-F1121L-01 50 Tests

Elab Fluor® 488 Anti-Mouse Ly6C Antibody[Monts 1]

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Mouse Ly6C Antibody[Monts 1]
E-AB-F1121L-02 100 Tests

Elab Fluor® 488 Anti-Mouse Ly6C Antibody[Monts 1]

Sign In for Pricing
View Details