Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPC25 Peptide - C-terminal region

SPC25 Peptide - C-terminal region

Product Specifications

Product Name Alternative

AD024, SPBC25, hSpc25

UniProt

Q9HBM1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_065726.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SPFMFSLHLNEARDYEVSDSAPHLEGLAEFQENVRKTNNFSAFLANVRKA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human ZDHHC18 sgRNA gene knockout kit - Lentiviral human ZDHHC18 sgRNA gene knockout kit (100)
GTR15356064 1 Vial

Lentiviral human ZDHHC18 sgRNA gene knockout kit - Lentiviral human ZDHHC18 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
DDX4 Polyclonal Antibody, PerCP Conjugated
bs-41225R-PerCP 100 µL

DDX4 Polyclonal Antibody, PerCP Conjugated

Sign In for Pricing
View Details
Apolipoprotein C-II
orb1643984-01 50 µg

Apolipoprotein C-II

Sign In for Pricing
View Details
Apolipoprotein C-II
orb1643984-02 100 µg

Apolipoprotein C-II

Sign In for Pricing
View Details
Apolipoprotein C-II
orb1643984-03 1 mg

Apolipoprotein C-II

Sign In for Pricing
View Details
SETP7 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV748299 1.0 µg DNA

SETP7 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details