Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPC25 Peptide - C-terminal region

SPC25 Peptide - C-terminal region

Product Specifications

Product Name Alternative

AD024, SPBC25, hSpc25

UniProt

Q9HBM1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_065726.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SPFMFSLHLNEARDYEVSDSAPHLEGLAEFQENVRKTNNFSAFLANVRKA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human recombinant MIF (Macrophage migration inhibitory factor) protein, AF
PROTP14174-9-5ug 5 µg

Human recombinant MIF (Macrophage migration inhibitory factor) protein, AF

Sign In for Pricing
View Details
3-Oxo-5β-cholanoic Acid
sc-477780 500 mg

3-Oxo-5β-cholanoic Acid

Sign In for Pricing
View Details
TIEG2 Polyclonal Antibody
MBS2539589-01 0.02 mL

TIEG2 Polyclonal Antibody

Sign In for Pricing
View Details
TIEG2 Polyclonal Antibody
MBS2539589-02 0.06 mL

TIEG2 Polyclonal Antibody

Sign In for Pricing
View Details
TIEG2 Polyclonal Antibody
MBS2539589-03 0.12 mL

TIEG2 Polyclonal Antibody

Sign In for Pricing
View Details
TIEG2 Polyclonal Antibody
MBS2539589-04 0.2 mL

TIEG2 Polyclonal Antibody

Sign In for Pricing
View Details