Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SOX13 Peptide - middle region

SOX13 Peptide - middle region

Product Specifications

Product Name Alternative

ICA12, Sox-13

UniProt

P35711

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_005677.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: WKSMTNQEKQPYYEEQARLSRQHLEKYPDYKYKPRPKRTCIVEGKRLRVG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STOML1 Rabbit Polyclonal Antibody
TA366547 100 µL

STOML1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Semaphorin 5B (SEMA5B) Antibody
abx101370-01 100 µL

Semaphorin 5B (SEMA5B) Antibody

Sign In for Pricing
View Details
Semaphorin 5B (SEMA5B) Antibody
abx101370-02 200 µL

Semaphorin 5B (SEMA5B) Antibody

Sign In for Pricing
View Details
Semaphorin 5B (SEMA5B) Antibody
abx101370-03 1 mL

Semaphorin 5B (SEMA5B) Antibody

Sign In for Pricing
View Details
Frizzled 10/CD350 Rabbit Polyclonal Antibody (APC-Cy7)
orb2526811 100 µL

Frizzled 10/CD350 Rabbit Polyclonal Antibody (APC-Cy7)

Sign In for Pricing
View Details
APG4B Recombinant Antibody, AbBy Fluor™ 594 Conjugated
bsm-61514R-BF594-TR 20 µL

APG4B Recombinant Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details