Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EBNA1BP2 Peptide - middle region

EBNA1BP2 Peptide - middle region

Product Specifications

Product Name Alternative

P40, EBP2, NOBP

UniProt

Q99848

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001153408.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KNQKFGFGGKKKGSKWNTRESYDDVSSFRAKTAHGRGLKRPGKKGSNKRP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LRRC3C (NM_001195545) Human Over-expression Lysate
LS100505591-100ug 100 µg

LRRC3C (NM_001195545) Human Over-expression Lysate

Sign In for Pricing
View Details
Rbsn Mouse siRNA Oligo Duplex (Locus ID 78287)
SR420101 1 Kit

Rbsn Mouse siRNA Oligo Duplex (Locus ID 78287)

Sign In for Pricing
View Details
SFTPB Human Over-expression Lysate
orb1341791 100 µg

SFTPB Human Over-expression Lysate

Sign In for Pricing
View Details
P2Y10 (P2RY10) (NM_014499) Human Over-expression Lysate
LS027334-100ug 100 µg

P2Y10 (P2RY10) (NM_014499) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Clostridium acetobutylicum Thiamine-phosphate synthase (thiE)
MBS1289685-01 0.02 mg (E-Coli)

Recombinant Clostridium acetobutylicum Thiamine-phosphate synthase (thiE)

Sign In for Pricing
View Details
Recombinant Clostridium acetobutylicum Thiamine-phosphate synthase (thiE)
MBS1289685-02 0.1 mg (E-Coli)

Recombinant Clostridium acetobutylicum Thiamine-phosphate synthase (thiE)

Sign In for Pricing
View Details