Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NANOS2 Peptide - C-terminal region

NANOS2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

NOS2, ZC2HC12B

UniProt

P60321

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001025032.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VVCPILRHYVCPVCGATGDQAHTLKYCPLNGGQQSLYRRSGRNSAGRRVK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APBA2BP Double Nickase Plasmid (m)
sc-425321-NIC 20 µg

APBA2BP Double Nickase Plasmid (m)

Sign In for Pricing
View Details
GLX351322 50mg
A20327-50 50 mg

GLX351322 50mg

Sign In for Pricing
View Details
Recombinant Rat Sodium/calcium exchanger 2 (Slc8a2) , partial
MBS958447-01 1 mg (E-Coli)

Recombinant Rat Sodium/calcium exchanger 2 (Slc8a2) , partial

Sign In for Pricing
View Details
Recombinant Rat Sodium/calcium exchanger 2 (Slc8a2) , partial
MBS958447-02 1 mg (Yeast)

Recombinant Rat Sodium/calcium exchanger 2 (Slc8a2) , partial

Sign In for Pricing
View Details
Phospho-CDKN1B (Thr198) Antibody
A73473-100UL 100 µL

Phospho-CDKN1B (Thr198) Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal Antibody
TA397555 100 µg

Rabbit Polyclonal Antibody

Sign In for Pricing
View Details