Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NANOS2 Peptide - C-terminal region

NANOS2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

NOS2, ZC2HC12B

UniProt

P60321

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001025032.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VVCPILRHYVCPVCGATGDQAHTLKYCPLNGGQQSLYRRSGRNSAGRRVK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KCNA10 Antibody
GWB-MM034G 50 µg

KCNA10 Antibody

Sign In for Pricing
View Details
Rabbit anti-Caenorhabditis elegans B0280.9 Polyclonal Antibody
MBS7142782 Inquire

Rabbit anti-Caenorhabditis elegans B0280.9 Polyclonal Antibody

Sign In for Pricing
View Details
Syt5 AAV siRNA Pooled Vector
46006164 1.0 µg

Syt5 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
OcuLar development associated gene (GATAD1) (NM_021167) Human Tagged ORF Clone Lentiviral Particle
RC202984L2V 200 µL

OcuLar development associated gene (GATAD1) (NM_021167) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
DISC1 (NM_001164549) Human Untagged Clone
SC327076 10 µg

DISC1 (NM_001164549) Human Untagged Clone

Sign In for Pricing
View Details
1,12-Diisothiocyanatododecane
410565-01 250 mg

1,12-Diisothiocyanatododecane

Sign In for Pricing
View Details