RFC3 Peptide - middle region
RFC3 Peptide - middle region
Product Specifications
Product Name Alternative
RFC38
UniProt
P40938
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_002906.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: TPSKKKIEISTIASNYHLEVNPSDAGNSDRVVIQEMLKTVAQSQQLETNS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15150163 1 Vial
Lentiviral mouse Srsf6 shRNA (UAS) - Lentiviral mouse Srsf6 shRNA (UAS) plasmid
Sign In for Pricing
View Details 
MBS1179639-01 0.02 mg (E-Coli)
Recombinant Rat Protein-lysine 6-oxidase
Sign In for Pricing
View Details MBS1179639-02 0.1 mg (E-Coli)
Recombinant Rat Protein-lysine 6-oxidase
Sign In for Pricing
View Details MBS1179639-03 1 mg (E-Coli)
Recombinant Rat Protein-lysine 6-oxidase
Sign In for Pricing
View Details MBS1179639-04 5x 1 mg (E-Coli)
Recombinant Rat Protein-lysine 6-oxidase
Sign In for Pricing
View Details