Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

APOBEC3H Peptide - N-terminal region

APOBEC3H Peptide - N-terminal region

Product Specifications

Product Name Alternative

A3H, ARP10, ARP-10

UniProt

Q6NTF7

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001159474.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QFNNKRRLRRPYYPRKALLCYQLTPQNGSTPTRGYFENKKKCHAEICFIN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Protein Kinase D2 (PRKD2) (NM_016457) Human Over-expression Lysate
LY402555 100 µg

Protein Kinase D2 (PRKD2) (NM_016457) Human Over-expression Lysate

Sign In for Pricing
View Details
Human FKBPL activation kit by CRISPRa
GA111931 1 Kit

Human FKBPL activation kit by CRISPRa

Sign In for Pricing
View Details
UACA / Nucling (AE-5), CF640R conjugate, 0.1mg/mL
BNC400956-100 1x 100 µL

UACA / Nucling (AE-5), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chimaerin 2 (CHN2) (NM_001293081) Human Tagged ORF Clone
RG237006 10 µg

Chimaerin 2 (CHN2) (NM_001293081) Human Tagged ORF Clone

Sign In for Pricing
View Details
trans-Zeatin-9-glucoside
TRC-Z273072-50MG 50 mg

trans-Zeatin-9-glucoside

Sign In for Pricing
View Details
DENND5B Human qPCR Primer Pair (NM_144973)
HP217313 200 Reactions

DENND5B Human qPCR Primer Pair (NM_144973)

Sign In for Pricing
View Details