Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

APOBEC3H Peptide - N-terminal region

APOBEC3H Peptide - N-terminal region

Product Specifications

Product Name Alternative

A3H, ARP10, ARP-10

UniProt

Q6NTF7

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001159474.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QFNNKRRLRRPYYPRKALLCYQLTPQNGSTPTRGYFENKKKCHAEICFIN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin, HMW (AE-3), CF594 conjugate, 0.1mg/mL
BNC940257-100 1x 100 µL

Cytokeratin, HMW (AE-3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cdk9 Recombinant Rabbit Monoclonal Antibody [SD204-07]
ET1612-78 100 µL

Cdk9 Recombinant Rabbit Monoclonal Antibody [SD204-07]

Sign In for Pricing
View Details
Polystyrene A CHO
HA50056006.100G 100 g

Polystyrene A CHO

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (EGP40/1555R), CF647 conjugate, 0.1mg/mL
BNC471555-100 1x 100 µL

Ep-CAM / CD326 (Epithelial Marker) (EGP40/1555R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Granzyme B Antibody (Biotin)
KB-9806-01 50 μL

Granzyme B Antibody (Biotin)

Sign In for Pricing
View Details
Granzyme B Antibody (Biotin)
KB-9806-02 100 µL

Granzyme B Antibody (Biotin)

Sign In for Pricing
View Details