Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD3EAP Peptide - N-terminal region

CD3EAP Peptide - N-terminal region

Product Specifications

Product Name Alternative

ASE1, CAST, ASE-1, PAF49

UniProt

O15446

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001284519.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AARFSCPPNFTAKPPASESPRFSLEALTGPDTELWLIQAPADFAPECFNG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MICS1 (GHITM) Rabbit Polyclonal Antibody
TA364889 100 µL

MICS1 (GHITM) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PAX8 (Renal Cell Marker) (PAX8/1492), CF594 conjugate, 0.1mg/mL
BNC941492-100 1x 100 µL

PAX8 (Renal Cell Marker) (PAX8/1492), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TTLL12 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI13H9]
TA500775BM 100 µL

TTLL12 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI13H9]

Sign In for Pricing
View Details
IL18BP (NM_001145057) Human Over-expression Lysate
LC428669 20 µg

IL18BP (NM_001145057) Human Over-expression Lysate

Sign In for Pricing
View Details
Human Protein Kinase C Zeta (PKCz) ELISA Kit
RD-PKCz-Hu-01 96 Tests

Human Protein Kinase C Zeta (PKCz) ELISA Kit

Sign In for Pricing
View Details
Human Protein Kinase C Zeta (PKCz) ELISA Kit
RD-PKCz-Hu-02 48 Tests

Human Protein Kinase C Zeta (PKCz) ELISA Kit

Sign In for Pricing
View Details