Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TACC2 Peptide - middle region

TACC2 Peptide - middle region

Product Specifications

Product Name Alternative

AZU-1, ECTACC

UniProt

O95359

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001278807.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KSPKRSPLSDPPSQDPTPAATPETPPVISAVVHATDEEKLAVTNQKWTCM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse NPY5R (Neuropeptide Y Receptor Y5) ELISA Kit
EK245803 96 Well

Mouse NPY5R (Neuropeptide Y Receptor Y5) ELISA Kit

Sign In for Pricing
View Details
SERPINB2 sgRNA CRISPR Lentivector (Human) (Target 3)
K2124304 1.0 µg DNA

SERPINB2 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Phospho-TBK1 (Ser172) Recombinant Antibody, AbBy Fluor™ 555 Conjugated
bsm-60659R-BF555-TR 20 µL

Phospho-TBK1 (Ser172) Recombinant Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
NDUFV3 Polyclonal Antibody
ANT-13418-100ug 100 µg

NDUFV3 Polyclonal Antibody

Sign In for Pricing
View Details
Extracto, 150 ml Tube Top Vacuum Filter System, 0.22μm, PVDF Membrane, Sterile, Individual Wrap
EXBU0150BPV02AWS 24 Pieces/Case:1 Piece/ PACKS:24 PACKS/CASE

Extracto, 150 ml Tube Top Vacuum Filter System, 0.22μm, PVDF Membrane, Sterile, Individual Wrap

Sign In for Pricing
View Details
LSP1P1 AAV Vector (Human) (CMV)
27755101 1 µg

LSP1P1 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details