Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TACC2 Peptide - middle region

TACC2 Peptide - middle region

Product Specifications

Product Name Alternative

AZU-1, ECTACC

UniProt

O95359

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001278807.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KSPKRSPLSDPPSQDPTPAATPETPPVISAVVHATDEEKLAVTNQKWTCM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AdmiRa-hsa-miR-6886-5p Virus
mh2644 250 µL

AdmiRa-hsa-miR-6886-5p Virus

Sign In for Pricing
View Details
Lentiviral mouse Med31 shRNA (UAS) - Lentiviral mouse Med31 shRNA (UAS) (25)
GTR15140429 1 Vial

Lentiviral mouse Med31 shRNA (UAS) - Lentiviral mouse Med31 shRNA (UAS) (25)

Sign In for Pricing
View Details
Iqub (NM_001034130) Rat Untagged Clone
RN213396 10 µg

Iqub (NM_001034130) Rat Untagged Clone

Sign In for Pricing
View Details
Complement H (CFH), BioAssayTM ELISA Kit (Human)
352793 96 Tests

Complement H (CFH), BioAssayTM ELISA Kit (Human)

Sign In for Pricing
View Details
MOAP1 CRISPR Activation Plasmid (h)
sc-408271-ACT 20 µg

MOAP1 CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
SDCBP antibody - middle region
MBS3207428-01 0.1 mL

SDCBP antibody - middle region

Sign In for Pricing
View Details