What is the catalog number for BRCC3 Peptide - middle region?

The catalog number for BRCC3 Peptide - middle region is orb1998593.

What sizes are available for BRCC3 Peptide - middle region?

BRCC3 Peptide - middle region is available in the following size(s): 100 µg.

Is BRCC3 Peptide - middle region in stock?

BRCC3 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

BRCC3 Peptide - middle region

Product Specifications

Product Name Alternative

C6.1A, BRCC36, CXorf53

UniProt

P46736

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001018065.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VRIVHIHSVIILRRSDKRKDRVEISPEQLSAASTEAERLAELTGRPMRVV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SL-IL-10-IND 1 PC/Bag, 5000 PCS/CTN

Inoculation Loops/Needles

Sign In for Pricing

View Details

MBS6454995-01 0.2 mL

CDX4 (Homeobox Protein CDX-4, Caudal-Type Homeobox Protein 4, CDX4) (PE)

Sign In for Pricing

View Details

MBS6454995-02 5x 0.2 mL

CDX4 (Homeobox Protein CDX-4, Caudal-Type Homeobox Protein 4, CDX4) (PE)

Sign In for Pricing

View Details

PC1008351 1 Each

(E) -JP-2-196 (TFA)

Sign In for Pricing

View Details

HY-N14799 1 Each

Mycobacillin

Sign In for Pricing

View Details

orb326028 100 µL

CATSPERE Rabbit Polyclonal Antibody

Sign In for Pricing

View Details