BRCC3 Peptide - middle region
BRCC3 Peptide - middle region
Product Specifications
Product Name Alternative
C6.1A, BRCC36, CXorf53
UniProt
P46736
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001018065.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: VRIVHIHSVIILRRSDKRKDRVEISPEQLSAASTEAERLAELTGRPMRVV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
C05940-100uL*2 2x 100μL
Ubiquinol-Cytochrome C Reductase Core Protein I Mouse mAb
Sign In for Pricing
View Details 
NBP1-30457FR 0.1 mL
Rabbit Polyclonal ARID3B Antibody [DyLight 680]
Sign In for Pricing
View Details MBS651086-01 0.02 mg
Tumor Necrosis Factor alpha, Recombinant, Canine (TNFa)
Sign In for Pricing
View Details MBS651086-02 5x 0.02 mg
Tumor Necrosis Factor alpha, Recombinant, Canine (TNFa)
Sign In for Pricing
View Details 
MBS009708-01 48 Well
Porcine Heat Shock Transcription Factor 2 ELISA Kit
Sign In for Pricing
View Details