IMP4 Peptide - C-terminal region
IMP4 Peptide - C-terminal region
Product Specifications
Product Name Alternative
BXDC4
UniProt
Q96G21
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001307233.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: YKKTDHRNVELTEVGPRFELKLYMIRLGTLEQEATADVEWRWHPYTNTAR
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
23433091 4x 500 ng
HLA-DQA1-set siRNA/shRNA/RNAi Lentivector (Human)
Sign In for Pricing
View Details 
MBS1453404-01 0.02 mg (E-Coli)
Recombinant Bovine HD domain-containing protein 2 (HDDC2)
Sign In for Pricing
View Details MBS1453404-02 0.1 mg (E-Coli)
Recombinant Bovine HD domain-containing protein 2 (HDDC2)
Sign In for Pricing
View Details MBS1453404-03 0.02 mg (Yeast)
Recombinant Bovine HD domain-containing protein 2 (HDDC2)
Sign In for Pricing
View Details MBS1453404-04 0.1 mg (Yeast)
Recombinant Bovine HD domain-containing protein 2 (HDDC2)
Sign In for Pricing
View Details