Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSH2D Peptide - middle region

HSH2D Peptide - middle region

Product Specifications

Product Name Alternative

ALX, HSH2

UniProt

Q96JZ2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001278203.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TQPCRQKDPANVDYEDLFLYSNAVAEEAACPVSAPEEASPKPVLCHQSKE

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Cofilin 2 Antibody [DyLight 650]
NBP2-98910C 0.1 mL

Rabbit Polyclonal Cofilin 2 Antibody [DyLight 650]

Sign In for Pricing
View Details
SIVA1 Protein Vector (Rat) (pPM-C-HA)
PV305060 500 ng

SIVA1 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Recombinant Human MSI2, GST-tagged
MSI2-1115H 25 µg

Recombinant Human MSI2, GST-tagged

Sign In for Pricing
View Details
VPS28 Peptide
46-580P 0.1 mg

VPS28 Peptide

Sign In for Pricing
View Details
1-[2-Hydroxy-3- (trifluoromethyl) phenyl]ethan-1-one
UVB50167-01 50 mg

1-[2-Hydroxy-3- (trifluoromethyl) phenyl]ethan-1-one

Sign In for Pricing
View Details
1-[2-Hydroxy-3- (trifluoromethyl) phenyl]ethan-1-one
UVB50167-02 0.5 g

1-[2-Hydroxy-3- (trifluoromethyl) phenyl]ethan-1-one

Sign In for Pricing
View Details