Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSH2D Peptide - middle region

HSH2D Peptide - middle region

Product Specifications

Product Name Alternative

ALX, HSH2

UniProt

Q96JZ2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001278203.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TQPCRQKDPANVDYEDLFLYSNAVAEEAACPVSAPEEASPKPVLCHQSKE

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit High mobility group protein 17 ELISA kit
GTR10452448 96 Well

Rabbit High mobility group protein 17 ELISA kit

Sign In for Pricing
View Details
Canine D-Dimer ELISA Kit
MBS753295-01 48 Well

Canine D-Dimer ELISA Kit

Sign In for Pricing
View Details
Canine D-Dimer ELISA Kit
MBS753295-02 96 Well

Canine D-Dimer ELISA Kit

Sign In for Pricing
View Details
Canine D-Dimer ELISA Kit
MBS753295-03 5x 96 Well

Canine D-Dimer ELISA Kit

Sign In for Pricing
View Details
Canine D-Dimer ELISA Kit
MBS753295-04 10x 96 Well

Canine D-Dimer ELISA Kit

Sign In for Pricing
View Details
Dact3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K3231406 1.0 µg DNA

Dact3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details