CTNNBL1 Peptide - N-terminal region
CTNNBL1 Peptide - N-terminal region
Product Specifications
Product Name Alternative
NAP, P14L, PP8304, C20orf33, dJ633O20.1
UniProt
Q8WYA6
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001268424.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ELLSYQPNRGTKRPRDDEEEEQKMRRKQTGTRERGRYREEEMTVVEEADD
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC881081-500 1x 500 µL
CD45RO (190-2F2.5), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940253-100 1x 100 µL
Cytokeratin, LMW (AE-1), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470965-500 1x 500 µL
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940956-100 1x 100 µL
UACA / Nucling (AE-5), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC471687-500 1x 500 µL
VEGF (Vascular Endothelial Growth Factor) (VG76e), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details