Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CIP2A Peptide - middle region

CIP2A Peptide - middle region

Product Specifications

Product Name Alternative

P90, KIAA1524

UniProt

Q8TCG1

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_065941.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MDLLKNPKIADYLTRYEHFSSCLHQVLGLLNGKDPDSSSKVLELLLAFCS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SEMA6C activation kit by CRISPRa
GA107174 1 Kit

Human SEMA6C activation kit by CRISPRa

Sign In for Pricing
View Details
Human IgG kapa light chain Mouse Monoclonal Antibody [A11-G11]
M0908-1 100 µL

Human IgG kapa light chain Mouse Monoclonal Antibody [A11-G11]

Sign In for Pricing
View Details
Bis(maltolato)oxovanadium(IV)
TRC-B478500-25G 25 g

Bis(maltolato)oxovanadium(IV)

Sign In for Pricing
View Details
4’’’-O-Chloroacetyl-tylosin 3-Acetate
TRC-C363790-1MG 1 mg

4’’’-O-Chloroacetyl-tylosin 3-Acetate

Sign In for Pricing
View Details
Tetramethylrhodamine-Alpha-Bungarotoxin, 500 ug
#00012 1x 500 µg

Tetramethylrhodamine-Alpha-Bungarotoxin, 500 ug

Sign In for Pricing
View Details
Parathyroid Hormone (PTH) (NM_000315) Human Recombinant Protein
TP720009M 50 µg

Parathyroid Hormone (PTH) (NM_000315) Human Recombinant Protein

Sign In for Pricing
View Details