Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CIP2A Peptide - middle region

CIP2A Peptide - middle region

Product Specifications

Product Name Alternative

P90, KIAA1524

UniProt

Q8TCG1

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_065941.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MDLLKNPKIADYLTRYEHFSSCLHQVLGLLNGKDPDSSSKVLELLLAFCS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Kidney
CS803168 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
CCN1 (CYR61) Human Gene Knockout Kit (CRISPR)
KN203492BN 1 Kit

CCN1 (CYR61) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Bim (BCL2L11) Rabbit Polyclonal Antibody
TA374008 100 µL

Bim (BCL2L11) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Neoantimycin
TRC-N389908-5MG 5 mg

Neoantimycin

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (MUC1/2818R), CF405S conjugate, 0.1mg/mL
BNC042818-500 1x 500 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (MUC1/2818R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DNAH2 (N-term) Rabbit Polyclonal Antibody
AP51283PU-N 400 µL

DNAH2 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details