Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SEC24C Peptide - middle region

SEC24C Peptide - middle region

Product Specifications

UniProt

P53992

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_004913.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FGGPSVSQPNHVSSPPQALPPGTQMTGPLGPLPPMHSPQQPGYQPQQNGS

More Discoveries

Explore Other Products

Browse additional items from our catalog

FastScan™ Phospho-SMAD2 (Ser465/467) ELISA Kit
CST 86932V4 50 Kits

FastScan™ Phospho-SMAD2 (Ser465/467) ELISA Kit

Sign In for Pricing
View Details
Human Mannose Phosphate Isomerase (MPI) ELISA Kit
DLR-MPI-Hu-48T 48 Tests

Human Mannose Phosphate Isomerase (MPI) ELISA Kit

Sign In for Pricing
View Details
TPA (UK98/6) : m-IgG Fc BP-HRP Bundle
sc-539238 1 Kit

TPA (UK98/6) : m-IgG Fc BP-HRP Bundle

Sign In for Pricing
View Details
Vacuolar Protein sorting 45 homolog (S. cerevisiae)
339299 100 µL

Vacuolar Protein sorting 45 homolog (S. cerevisiae)

Sign In for Pricing
View Details
SEC23B Mouse Monoclonal Antibody [Clone:8F3]
E45M19483 100 µg

SEC23B Mouse Monoclonal Antibody [Clone:8F3]

Sign In for Pricing
View Details
Recombinant Escherichia coli Ferrichrome-iron receptor (fhuA), partial
orb2658911-01 20 µg

Recombinant Escherichia coli Ferrichrome-iron receptor (fhuA), partial

Sign In for Pricing
View Details