Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SEC24C Peptide - middle region

SEC24C Peptide - middle region

Product Specifications

UniProt

P53992

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_004913.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FGGPSVSQPNHVSSPPQALPPGTQMTGPLGPLPPMHSPQQPGYQPQQNGS

More Discoveries

Explore Other Products

Browse additional items from our catalog

4'-Chloro-3-Phenylpropiophenone
OR1011501 1 Each

4'-Chloro-3-Phenylpropiophenone

Sign In for Pricing
View Details
C2orf44 Polyclonal Antibody, APC-Cy7 Conjugated
bs-9814R-APC-Cy7 100 µL

C2orf44 Polyclonal Antibody, APC-Cy7 Conjugated

Sign In for Pricing
View Details
CPA6 Antibody
OAAN01839-200UL 200 µL

CPA6 Antibody

Sign In for Pricing
View Details
PRSS8 Antibody, FITC conjugated
A55807-100UG 100 µg

PRSS8 Antibody, FITC conjugated

Sign In for Pricing
View Details
KRT23 Polyclonal Antibody
MBS8578745-01 0.1 mL

KRT23 Polyclonal Antibody

Sign In for Pricing
View Details
KRT23 Polyclonal Antibody
MBS8578745-02 0.1 mL (AF405L)

KRT23 Polyclonal Antibody

Sign In for Pricing
View Details