Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TULP3 Peptide - middle region

TULP3 Peptide - middle region

Product Specifications

Product Name Alternative

TUBL3

UniProt

O75386

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001153880.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DRGICPMKGRGLVGAAHTRQELAAISYETNVLGFKGPRKMSVIIPGMTLN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

6-Chloro-2-fluoronicotinonitrile
JH916058 1 Each

6-Chloro-2-fluoronicotinonitrile

Sign In for Pricing
View Details
GAS6 Recombinant Protein (Rat)
RP202262 100 µg

GAS6 Recombinant Protein (Rat)

Sign In for Pricing
View Details
Human Cytochrome c oxidase subunit 4 isoform 1, mitochondrial ELISA Kit
orb1660744 96 Tests

Human Cytochrome c oxidase subunit 4 isoform 1, mitochondrial ELISA Kit

Sign In for Pricing
View Details
Major histocompatibility complex-II (MHC-II/H-2II) Mouse ELISA Kit
20111 96 Tests

Major histocompatibility complex-II (MHC-II/H-2II) Mouse ELISA Kit

Sign In for Pricing
View Details
Recombinant Rana dybowskii Brevinin-1CDYa
MBS1110558-01 0.05 mg (E-Coli)

Recombinant Rana dybowskii Brevinin-1CDYa

Sign In for Pricing
View Details
Recombinant Rana dybowskii Brevinin-1CDYa
MBS1110558-02 0.2 mg (E-Coli)

Recombinant Rana dybowskii Brevinin-1CDYa

Sign In for Pricing
View Details