Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TULP3 Peptide - middle region

TULP3 Peptide - middle region

Product Specifications

Product Name Alternative

TUBL3

UniProt

O75386

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001153880.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DRGICPMKGRGLVGAAHTRQELAAISYETNVLGFKGPRKMSVIIPGMTLN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Interleukin-13, Active, Recombinant, Mouse, aa22-131 (Il13) discontinued
586949-01 10 µg

Interleukin-13, Active, Recombinant, Mouse, aa22-131 (Il13) discontinued

Sign In for Pricing
View Details
Interleukin-13, Active, Recombinant, Mouse, aa22-131 (Il13) discontinued
586949-02 50 µg

Interleukin-13, Active, Recombinant, Mouse, aa22-131 (Il13) discontinued

Sign In for Pricing
View Details
Anti-IL-8 Antibody (Detection)
MBS8327410-01 0.1 mg

Anti-IL-8 Antibody (Detection)

Sign In for Pricing
View Details
Anti-IL-8 Antibody (Detection)
MBS8327410-02 1 mg

Anti-IL-8 Antibody (Detection)

Sign In for Pricing
View Details
Anti-IL-8 Antibody (Detection)
MBS8327410-03 5x 1 mg

Anti-IL-8 Antibody (Detection)

Sign In for Pricing
View Details
PRMT3 antibody
70R-3706 100 µL

PRMT3 antibody

Sign In for Pricing
View Details