Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANXA11 Peptide - middle region

ANXA11 Peptide - middle region

Product Specifications

Product Name Alternative

ANX11, CAP50

UniProt

P50995

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001148.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PGAPGAGYPPVPPGGFGQPPSAQQPVPPYGMYPPPGGNPPSRMPSYPPYP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UBASH3A Antibody
KC-43000-01 50 μL

UBASH3A Antibody

Sign In for Pricing
View Details
UBASH3A Antibody
KC-43000-02 100 µL

UBASH3A Antibody

Sign In for Pricing
View Details
UBASH3A Antibody
KC-43000-03 1 mL

UBASH3A Antibody

Sign In for Pricing
View Details
WNT9B (NM_003396) Human Over-expression Lysate
LC401159 20 µg

WNT9B (NM_003396) Human Over-expression Lysate

Sign In for Pricing
View Details
Human COMP Antibody Pair Set
E-KAB-0261 50 µL & 100 µg

Human COMP Antibody Pair Set

Sign In for Pricing
View Details
Frozen Tissue Sections, Myometrium
CS502135 5x 5 µm

Frozen Tissue Sections, Myometrium

Sign In for Pricing
View Details