Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANXA11 Peptide - middle region

ANXA11 Peptide - middle region

Product Specifications

Product Name Alternative

ANX11, CAP50

UniProt

P50995

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001148.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PGAPGAGYPPVPPGGFGQPPSAQQPVPPYGMYPPPGGNPPSRMPSYPPYP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HHAT (NM_018194) Human Recombinant Protein
TP308447L 1 mg

HHAT (NM_018194) Human Recombinant Protein

Sign In for Pricing
View Details
c Fos (FOS) (NM_005252) Human Over-expression Lysate
LY401614 100 µg

c Fos (FOS) (NM_005252) Human Over-expression Lysate

Sign In for Pricing
View Details
Cnpy3 Mouse Gene Knockout Kit (CRISPR)
KN503571 1 Kit

Cnpy3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF568 conjugate, 0.1mg/mL
BNC681429-100 1x 100 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tomosyn (STXBP5) (NM_001127715) Human Over-expression Lysate
LY426872 100 µg

Tomosyn (STXBP5) (NM_001127715) Human Over-expression Lysate

Sign In for Pricing
View Details
TLR4 Human Recombinant Protein, Synthetic Nanodisc
TP721508M 100 µg

TLR4 Human Recombinant Protein, Synthetic Nanodisc

Sign In for Pricing
View Details