Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TFIP11 Peptide - middle region

TFIP11 Peptide - middle region

Product Specifications

Product Name Alternative

NTR1, STIP, TIP39, STIP-1, Spp382, bK445C9.6

UniProt

Q9UBB9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001008697.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SERTTQSMQDFPVVDSEEEAEEEFQKELSQWRKDPSGSKKKPKYSYKTVE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CHIC2 Double Nickase Plasmid (h2)
sc-408854-NIC-2 20 µg

CHIC2 Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
ARFRP1 Polyclonal Antibody, Biotin Conjugated
A69894-050 50 μL

ARFRP1 Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
CP045 rabbit pAb
E28PN4953 100 µL

CP045 rabbit pAb

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae Protein BCH2 (BCH2) , partial
MBS1037991 Inquire

Recombinant Saccharomyces cerevisiae Protein BCH2 (BCH2) , partial

Sign In for Pricing
View Details
Anti-LIF Antibody Picoband® (Dylight594 Conjugate)
A01400-Dylight594 100 µg

Anti-LIF Antibody Picoband® (Dylight594 Conjugate)

Sign In for Pricing
View Details
MAPK8IP3 Adenovirus (Human)
28074051 1.0 mL

MAPK8IP3 Adenovirus (Human)

Sign In for Pricing
View Details